PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM10G09180.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 334aa    MW: 35124.1 Da    PI: 6.4281
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM10G09180.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92e-19108161356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k+++++ eq+++Le+ Fe+ +++  e++++LA+ lgL+ rqV +WFqNrRa++k
  OGLUM10G09180.2 108 KKRRLSVEQVRTLERSFESGNKLEPERKAQLARALGLQPRQVAIWFQNRRARWK 161
                      456899***********************************************9 PP

2HD-ZIP_I/II127.94.2e-41107198192
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      ekkrrls eqv++LE+sFe+ +kLeperK++lar+Lglqprqva+WFqnrRAR+ktkqlEkd++aL+r++da ++en++L + +++L++e+ 
  OGLUM10G09180.2 107 EKKRRLSVEQVRTLERSFESGNKLEPERKAQLARALGLQPRQVAIWFQNRRARWKTKQLEKDFDALRRQLDAARAENDALLSLNSKLHAEIV 198
                      69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-1986164IPR009057Homeodomain-like
SuperFamilySSF466891.03E-1997165IPR009057Homeodomain-like
PROSITE profilePS5007117.313103163IPR001356Homeobox domain
SMARTSM003891.8E-19106167IPR001356Homeobox domain
PfamPF000461.1E-16108161IPR001356Homeobox domain
CDDcd000862.28E-16108164No hitNo description
PRINTSPR000314.7E-6134143IPR000047Helix-turn-helix motif
PROSITE patternPS000270138161IPR017970Homeobox, conserved site
PRINTSPR000314.7E-6143159IPR000047Helix-turn-helix motif
PfamPF021831.5E-9163202IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MRPAMASNGA AAGAMAPFFP PNFLLQMQQP LPLHHQHLQD HAHGGHGGHH LLPPPPPSLS  60
PFLPDLAMDA PPPPMYEASG GDGGGGGAAS EDEEDGCGGG GGGGGGEKKR RLSVEQVRTL  120
ERSFESGNKL EPERKAQLAR ALGLQPRQVA IWFQNRRARW KTKQLEKDFD ALRRQLDAAR  180
AENDALLSLN SKLHAEIVAL KGGAAAAGGG GSSCRQEAAS ELINLNVKET EASCSNRSEN  240
SSEINLDISR PAPPPPPPPA NESPVNRGIP FYASIGRGGA GGVDIDQLLS CPRRAAACSR  300
RPRRATVPAA PPEMRGEESE GEGSEGERGE GEDK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1155163RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2877000.0AK287700.1 Oryza sativa Japonica Group cDNA, clone: J065130H05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613423.11e-141PREDICTED: homeobox-leucine zipper protein HOX23
SwissprotA2Z7341e-140HOX23_ORYSI; Homeobox-leucine zipper protein HOX23
SwissprotQ94GL51e-140HOX23_ORYSJ; Homeobox-leucine zipper protein HOX23
TrEMBLA0A0E0BA970.0A0A0E0BA97_9ORYZ; Uncharacterized protein
STRINGLOC_Os10g26500.11e-141(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22893894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.12e-46HD-ZIP family protein